PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016603.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 276aa    MW: 31482.5 Da    PI: 7.8882
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016603.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+++G g+W++++r  g++R +k+c++rw +yl
      Pbr016603.1 17 KGPWTPEEDKLLNEYVTLHGDGRWSSVPRSTGLNRNGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding49.69.1e-1671114247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g  T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++
      Pbr016603.1  71 GHITPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNFWRTH 114
                      667******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9681264IPR017930Myb domain
SuperFamilySSF466893.59E-3014111IPR009057Homeodomain-like
SMARTSM007172.9E-131666IPR001005SANT/Myb domain
PfamPF002499.0E-161764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-231871IPR009057Homeodomain-like
CDDcd001674.20E-91964No hitNo description
PROSITE profilePS5129424.465119IPR017930Myb domain
SMARTSM007174.7E-1469117IPR001005SANT/Myb domain
PfamPF002499.9E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-2472118IPR009057Homeodomain-like
CDDcd001673.79E-974115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MVAMMGWGGV GEQGWRKGPW TPEEDKLLNE YVTLHGDGRW SSVPRSTGLN RNGKSCRLRW  60
VNYLRPGLKK GHITPQEEGI IIELHALWGN KWSTIARYLP GRTDNEIKNF WRTHFKKKEK  120
CTQKQEKRKA EILKAKQQQL EEDQNMKARA TTPHHHWEAC SQGIISNMNN IDIHETQATW  180
QENMEEDKYC LPKLMHQASV EFWSDLLGEE GFYKLWNLDD VSGRMDLQQH TSLSQCNKAA  240
MQINNQGITA ALSSGGESCN ISLQNGSETS SPALF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231711827127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009373818.10.0PREDICTED: myb-related protein 340
TrEMBLM5WY492e-98M5WY49_PRUPE; Uncharacterized protein
STRINGSolyc02g089190.1.11e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.16e-64myb domain protein 121